Original price was: $81.49.$69.19Current price is: $69.19.
All products are for laboratory research purposes only. Not for human consumption.
In stock
For the 3,5 and 10 pack options, delivery may take between 7-10 business days
Bulk discount orders are available. Please enquire about your research needs at [email protected] .
| CAS Number | 143045-27-6 |
| Synonyms | Long arginine 3-IGF-1, LR3-IGF-1 |
| Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKP TGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Molecular Formula | C400H625N111O115S9 |
| Molecular Weight | 9117 |
| Content | 100mcg, 1mg |
| Physical Appearance | Fine White Lyophilized Powder |
| PubChem LCSS | — |
| Terms | Laboratory research use only (RUO). Not for human, animal, diagnostic, or household use. |
| Size | 1mg |
|---|
© 2026 BioLabs Peptides.
Terms of Service
Disclaimer: These products are intended for laboratory research purposes only. The products should not be used as a food, drug, cosmetic, or other household use. By accessing this website or purchasing from this website, you agree that that it is your sole responsibility to ensure compliance with applicable laws and regulations within your jurisdiction; and you understand and acknowledge that no information on this website should be construed as medical advice. You also acknowledge and agree that you have read the Terms of Service available on this website and agree that your rights and responsibilities are governed by the Terms of Service on this website. BioLabs Peptides is a chemical supplier and is not a compounding pharmacy or chemical compounding facility. Additionally, BioLabs Peptides is not an outsourcing facility.